We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · beta-Endorphin, rat · Reference sheet

beta-Endorphin, rat

Reference sheet · Opioid · CPC catalog code ENDP-009

Identity

Name
beta-Endorphin, rat
Catalog code
ENDP-009
Category
Opioid

Physicochemical properties

Sequence
H-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln-OH (trifluoroacetate salt)
One-letter
YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ
Residues
31 amino acids
Molecular formula
C157H254N42O44S computed from sequence
Molecular weight
3466.07 g/mol average mass, free peptide, computed
Net charge (pH 7)
+4.1 (6 basic / 1 acidic)
Hydrophobic residues
39%
Cysteine present
No

Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of beta-Endorphin, rat at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Opioid class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

beta-Endorphin, rat sits within the Opioid research class (CPC reference ENDP-009). Opioid peptides bind μ, δ, and κ receptors — Gi/o-coupled GPCRs that inhibit adenylate cyclase, activate GIRK channels, and modulate calcium currents to produce analgesia, tolerance, and reward-circuit effects. Investigators typically incorporate beta-Endorphin, rat as a reference standard, tool ligand, or substrate in the assay contexts listed above. GTPγS binding, cAMP HTRF, and β-arrestin PathHunter assays.

Studied for

  • Opioid-receptor binding and selectivity profiling
  • β-arrestin recruitment and biased-agonism studies
  • Analgesic mechanism research
  • Tolerance and dependence models

Frequently asked

What is beta-Endorphin, rat?

beta-Endorphin, rat (CPC catalog code ENDP-009) is a synthetic opioid-receptor research peptide in the opioid category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is beta-Endorphin, rat studied for?

Published and internal research programs use beta-Endorphin, rat as a reference standard in opioid workflows — for example, opioid-receptor binding and selectivity profiling and β-arrestin recruitment and biased-agonism studies. Human clinical evidence is not established.

Is beta-Endorphin, rat FDA-approved for human use?

No. beta-Endorphin, rat is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is beta-Endorphin, rat typically used in the lab?

In a opioid workflow, beta-Endorphin, rat is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. GTPγS binding, cAMP HTRF, and β-arrestin PathHunter assays.

Sources

View full product page →Back to catalog

Related peptides in Opioid

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

beta-Endorphin, human
beta-Endorphin (1-27), human
beta-Endorphin (1-26), human
Acetyl, beta-Endorphin, human
Biocytin-beta-Endorphin, human
Acetyl, beta-Endorphin (1-27), human
Acetyl, beta-Endorphin (1-26), human
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.