We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · (Pyr3)-Amyloid β-Protein (3-42) · Reference sheet

(Pyr3)-Amyloid β-Protein (3-42)

Reference sheet · Neurodegenerative · CPC catalog code AMYD-053

Identity

Name
(Pyr3)-Amyloid β-Protein (3-42)
Catalog code
AMYD-053
Category
Neurodegenerative

Physicochemical properties

Sequence
Pyr-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH (trifluoroacetate salt)
One-letter
FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Residues
39 amino acids
Modifications
Pyr
Net charge (pH 7)
-0.7 (6 basic / 4 acidic)
Hydrophobic residues
49%
Cysteine present
No

This sequence carries terminal or reporter modifications (Pyr), so no molecular formula or weight is published here — the modified mass must come from the lot certificate of analysis. Residue composition and charge describe the peptide backbone only. Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of (Pyr3)-Amyloid β-Protein (3-42) at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Neurodegenerative class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

(Pyr3)-Amyloid β-Protein (3-42) sits within the Neurodegenerative research class (CPC reference AMYD-053). These peptides (amyloid-β, α-synuclein, tau, prion fragments) form ordered β-sheet aggregates and oligomeric species that are used to interrogate seeding, propagation, and cellular toxicity mechanisms of neurodegeneration. Investigators typically incorporate (Pyr3)-Amyloid β-Protein (3-42) as a reference standard, tool ligand, or substrate in the assay contexts listed above. ThT fluorescence, AFM / TEM morphology, and neuronal-toxicity readouts (LDH, MTT).

Studied for

  • Aggregation kinetics (ThT, ANS fluorescence) studies
  • Oligomer- and fibril-mediated toxicity assays
  • Seeding and prion-like propagation models
  • Aggregation-inhibitor and antibody screening

Frequently asked

What is (Pyr3)-Amyloid β-Protein (3-42)?

(Pyr3)-Amyloid β-Protein (3-42) (CPC catalog code AMYD-053) is a synthetic neurodegenerative-disease research peptide in the neurodegenerative category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is (Pyr3)-Amyloid β-Protein (3-42) studied for?

Published and internal research programs use (Pyr3)-Amyloid β-Protein (3-42) as a reference standard in neurodegenerative workflows — for example, aggregation kinetics (tht, ans fluorescence) studies and oligomer- and fibril-mediated toxicity assays. Human clinical evidence is not established.

Is (Pyr3)-Amyloid β-Protein (3-42) FDA-approved for human use?

No. (Pyr3)-Amyloid β-Protein (3-42) is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is (Pyr3)-Amyloid β-Protein (3-42) typically used in the lab?

In a neurodegenerative workflow, (Pyr3)-Amyloid β-Protein (3-42) is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. ThT fluorescence, AFM / TEM morphology, and neuronal-toxicity readouts (LDH, MTT).

Sources

View full product page →Back to catalog

Related peptides in Neurodegenerative

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

beta-Amyloid Peptide (1-42), rat
beta-Amyloid (1-42)
Biotinyl- beta-Amyloid (1-42)
(Arg6)-Amyloid beta-Protein (1-40)
Amyloid beta-Protein (25-35)
Amyloid BRI Protein (1-23)
Amyloid BRI Protein (1-34) (reduced)
Amyloid Dan Protein (1-34)
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.