We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · beta-Amyloid Peptide (1-42), rat · Reference sheet

beta-Amyloid Peptide (1-42), rat

Reference sheet · Neurodegenerative · CPC catalog code AMYD-017

Identity

Name
beta-Amyloid Peptide (1-42), rat
Catalog code
AMYD-017
Category
Neurodegenerative

Physicochemical properties

Sequence
H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH (trifluoroacetate salt)
One-letter
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Residues
42 amino acids
Molecular formula
C199H307N53O59S computed from sequence
Molecular weight
4418.02 g/mol average mass, free peptide, computed
Net charge (pH 7)
-2.8 (5 basic / 6 acidic)
Hydrophobic residues
48%
Cysteine present
No

Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of beta-Amyloid Peptide (1-42), rat at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Neurodegenerative class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

beta-Amyloid Peptide (1-42), rat sits within the Neurodegenerative research class (CPC reference AMYD-017). These peptides (amyloid-β, α-synuclein, tau, prion fragments) form ordered β-sheet aggregates and oligomeric species that are used to interrogate seeding, propagation, and cellular toxicity mechanisms of neurodegeneration. Investigators typically incorporate beta-Amyloid Peptide (1-42), rat as a reference standard, tool ligand, or substrate in the assay contexts listed above. ThT fluorescence, AFM / TEM morphology, and neuronal-toxicity readouts (LDH, MTT).

Studied for

  • Aggregation kinetics (ThT, ANS fluorescence) studies
  • Oligomer- and fibril-mediated toxicity assays
  • Seeding and prion-like propagation models
  • Aggregation-inhibitor and antibody screening

Frequently asked

What is beta-Amyloid Peptide (1-42), rat?

beta-Amyloid Peptide (1-42), rat (CPC catalog code AMYD-017) is a synthetic neurodegenerative-disease research peptide in the neurodegenerative category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is beta-Amyloid Peptide (1-42), rat studied for?

Published and internal research programs use beta-Amyloid Peptide (1-42), rat as a reference standard in neurodegenerative workflows — for example, aggregation kinetics (tht, ans fluorescence) studies and oligomer- and fibril-mediated toxicity assays. Human clinical evidence is not established.

Is beta-Amyloid Peptide (1-42), rat FDA-approved for human use?

No. beta-Amyloid Peptide (1-42), rat is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is beta-Amyloid Peptide (1-42), rat typically used in the lab?

In a neurodegenerative workflow, beta-Amyloid Peptide (1-42), rat is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. ThT fluorescence, AFM / TEM morphology, and neuronal-toxicity readouts (LDH, MTT).

Sources

View full product page →Back to catalog

Related peptides in Neurodegenerative

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

beta-Amyloid (1-42)
Biotinyl- beta-Amyloid (1-42)
TAMRA-beta-Amyloid (1-42)
FAM-beta-Amyloid (1-42)
beta-Amyloid (17-42)
beta-Amyloid (1-40), rat
beta-Amyloid (1-40)
beta-Amyloid (40-1)
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.