We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · Urotensin I · Reference sheet

Urotensin I

Reference sheet · Cardiovascular · CPC catalog code UROT-001

Identity

Name
Urotensin I
Catalog code
UROT-001
Category
Cardiovascular

Physicochemical properties

Sequence
H-Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2 (trifluoroacetate salt)
One-letter
NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV
Residues
41 amino acids
Modifications
NH2
Net charge (pH 7)
-3.9 (6 basic / 9 acidic)
Hydrophobic residues
44%
Cysteine present
No

This sequence carries terminal or reporter modifications (NH2), so no molecular formula or weight is published here — the modified mass must come from the lot certificate of analysis. Residue composition and charge describe the peptide backbone only. Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of Urotensin I at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Cardiovascular class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

Urotensin I sits within the Cardiovascular research class (CPC reference UROT-001). Cardiovascular peptides act on GPCRs and receptor systems in vascular smooth muscle, endothelium, and cardiac myocytes — modulating vasoconstriction, natriuresis, RAAS signaling, or ionotropic responses. Effects are typically measured in isolated vessel, Langendorff heart, or receptor-transfected cell assays.</ Investigators typically incorporate Urotensin I as a reference standard, tool ligand, or substrate in the assay contexts listed above. Radioligand-binding, IP-1 / cAMP HTRF, and organ-bath tension recordings are the standard readouts.

Studied for

  • Vascular reactivity in aortic ring and mesenteric bed preparations
  • Renin–angiotensin–aldosterone system (RAAS) mechanistic studies
  • Natriuretic and diuretic pathway characterization
  • Cardiac remodeling and hypertrophy models

Frequently asked

What is Urotensin I?

Urotensin I (CPC catalog code UROT-001) is a synthetic cardiovascular research peptide in the cardiovascular category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is Urotensin I studied for?

Published and internal research programs use Urotensin I as a reference standard in cardiovascular workflows — for example, vascular reactivity in aortic ring and mesenteric bed preparations and renin–angiotensin–aldosterone system (raas) mechanistic studies. Human clinical evidence is not established.

Is Urotensin I FDA-approved for human use?

No. Urotensin I is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is Urotensin I typically used in the lab?

In a cardiovascular workflow, Urotensin I is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. Radioligand-binding, IP-1 / cAMP HTRF, and organ-bath tension recordings are the standard readouts.

Sources

View full product page →Back to catalog

Related peptides in Cardiovascular

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

Urotensin II , human
Urotensin II , goby
Orn8, Urotensin II, human
FAM-Bradykinin
Urocortin, rat
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.