We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · 3 x Hemagglutinin (HA) Tag · Reference sheet

3 x Hemagglutinin (HA) Tag

Reference sheet · Immune · CPC catalog code TAGP-001

Identity

Name
3 x Hemagglutinin (HA) Tag
Catalog code
TAGP-001
Category
Immune

Physicochemical properties

Sequence
H-Met-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Lys-Leu-Glu-OH (trifluoroacetate salt)
One-letter
MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
Residues
37 amino acids
Molecular formula
C205H272N38O67S computed from sequence
Molecular weight
4372.69 g/mol average mass, free peptide, computed
Net charge (pH 7)
-9 (1 basic / 10 acidic)
Hydrophobic residues
70%
Cysteine present
No

Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of 3 x Hemagglutinin (HA) Tag at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Immune class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

3 x Hemagglutinin (HA) Tag sits within the Immune research class (CPC reference TAGP-001). Immune peptides can serve as MHC-I / MHC-II epitopes, cytokine mimetics, TLR modulators, or antigenic tags. Function is measured by receptor engagement, cytokine release, or downstream T-cell / macrophage activation. Investigators typically incorporate 3 x Hemagglutinin (HA) Tag as a reference standard, tool ligand, or substrate in the assay contexts listed above. ELISA, ELISpot, tetramer staining, and flow cytometry are the standard readouts.

Studied for

  • MHC / TCR binding and T-cell activation assays
  • Cytokine release and inflammation modeling
  • TLR and pattern-recognition receptor screening
  • Adjuvant and vaccine-formulation research

Frequently asked

What is 3 x Hemagglutinin (HA) Tag?

3 x Hemagglutinin (HA) Tag (CPC catalog code TAGP-001) is a synthetic immunology research peptide in the immune category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is 3 x Hemagglutinin (HA) Tag studied for?

Published and internal research programs use 3 x Hemagglutinin (HA) Tag as a reference standard in immune workflows — for example, mhc / tcr binding and t-cell activation assays and cytokine release and inflammation modeling. Human clinical evidence is not established.

Is 3 x Hemagglutinin (HA) Tag FDA-approved for human use?

No. 3 x Hemagglutinin (HA) Tag is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is 3 x Hemagglutinin (HA) Tag typically used in the lab?

In a immune workflow, 3 x Hemagglutinin (HA) Tag is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. ELISA, ELISpot, tetramer staining, and flow cytometry are the standard readouts.

Sources

View full product page →Back to catalog

Related peptides in Immune

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

Rhodopsin Epitope Tag
Glu-Glu epitope Tag
HA 12CA5 Epitope
V5 Epitope Tag
Biotinyl-Obestatin (human)
Biotinyl-Obestatin (rat)
Pancreastatin (33-48) (human)
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.