We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · Parathyroid Hormone (1-34), human, biotinylated · Reference sheet

Parathyroid Hormone (1-34), human, biotinylated

Reference sheet · Bone / Cartilage · CPC catalog code PTHP-014

Identity

Name
Parathyroid Hormone (1-34), human, biotinylated
Catalog code
PTHP-014
Category
Bone / Cartilage

Physicochemical properties

Sequence
Biotin-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH (trifluoroacetate salt)
One-letter
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Residues
34 amino acids
Modifications
Biotin
Net charge (pH 7)
+1.3 (8 basic / 4 acidic)
Hydrophobic residues
38%
Cysteine present
No

This sequence carries terminal or reporter modifications (Biotin), so no molecular formula or weight is published here — the modified mass must come from the lot certificate of analysis. Residue composition and charge describe the peptide backbone only. Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of Parathyroid Hormone (1-34), human, biotinylated at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Bone / Cartilage class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

Parathyroid Hormone (1-34), human, biotinylated sits within the Bone / Cartilage research class (CPC reference PTHP-014). These peptides interact with bone- and cartilage-relevant receptors and matrix proteins — including RANK/RANKL, PTH1R, integrins, and collagen-binding motifs — modulating osteoblast, osteoclast, and chondrocyte activity in cellular and organ-culture models. Investigators typically incorporate Parathyroid Hormone (1-34), human, biotinylated as a reference standard, tool ligand, or substrate in the assay contexts listed above. Commonly paired with ALP, TRAP, or Alizarin Red staining in cell-based readouts.

Studied for

  • Osteoblast / osteoclast differentiation assays
  • Chondrocyte and cartilage-explant remodeling studies
  • Bone-resorption and mineralization models
  • Biomaterial functionalization for orthopaedic scaffolds

Frequently asked

What is Parathyroid Hormone (1-34), human, biotinylated?

Parathyroid Hormone (1-34), human, biotinylated (CPC catalog code PTHP-014) is a synthetic bone / cartilage biology peptide in the bone / cartilage category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is Parathyroid Hormone (1-34), human, biotinylated studied for?

Published and internal research programs use Parathyroid Hormone (1-34), human, biotinylated as a reference standard in bone / cartilage workflows — for example, osteoblast / osteoclast differentiation assays and chondrocyte and cartilage-explant remodeling studies. Human clinical evidence is not established.

Is Parathyroid Hormone (1-34), human, biotinylated FDA-approved for human use?

No. Parathyroid Hormone (1-34), human, biotinylated is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is Parathyroid Hormone (1-34), human, biotinylated typically used in the lab?

In a bone / cartilage workflow, Parathyroid Hormone (1-34), human, biotinylated is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. Commonly paired with ALP, TRAP, or Alizarin Red staining in cell-based readouts.

Sources

View full product page →Back to catalog

Related peptides in Bone / Cartilage

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

Parathyroid Hormone (1-34), human
Parathyroid Hormone (1-34), human
Parathyroid Hormone (1-34), rat
Parathyroid Hormone (1-34), bovine
Parathyroid Hormone (1-34), human, FAM-labeled
Parathyroid Hormone (1-34)-Lys(Biotin), human
[Nle8,18, Tyr34] Parathyroid Hormone (1-34), human
[Nle8,18,Tyr34] Parathyroid Hormone (3-34), amide, human
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.