We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · Peptide YY, PYY, porcine · Reference sheet

Peptide YY, PYY, porcine

Reference sheet · GI / Gut · CPC catalog code PEPY-004

Identity

Name
Peptide YY, PYY, porcine
Catalog code
PEPY-004
Category
GI / Gut

Physicochemical properties

Sequence
H-Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 (trifluoroacetate salt)
One-letter
YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY
Residues
36 amino acids
Modifications
NH2
Net charge (pH 7)
+0.1 (6 basic / 5 acidic)
Hydrophobic residues
50%
Cysteine present
No

This sequence carries terminal or reporter modifications (NH2), so no molecular formula or weight is published here — the modified mass must come from the lot certificate of analysis. Residue composition and charge describe the peptide backbone only. Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of Peptide YY, PYY, porcine at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the GI / Gut class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

Peptide YY, PYY, porcine sits within the GI / Gut research class (CPC reference PEPY-004). Gut peptides engage GPCRs on enteroendocrine cells, vagal afferents, and central nuclei, modulating motility, secretion, satiety, and glucose-dependent insulin release. Investigators typically incorporate Peptide YY, PYY, porcine as a reference standard, tool ligand, or substrate in the assay contexts listed above. cAMP HTRF, in vitro islet insulin secretion, and food-intake models in rodents.

Studied for

  • Incretin (GLP-1 / GIP) receptor signaling
  • Appetite and satiety-circuit research
  • Gastric motility and emptying assays
  • Gut–brain axis and vagal signaling models

Frequently asked

What is Peptide YY, PYY, porcine?

Peptide YY, PYY, porcine (CPC catalog code PEPY-004) is a synthetic gastrointestinal / gut-hormone peptide in the gi / gut category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is Peptide YY, PYY, porcine studied for?

Published and internal research programs use Peptide YY, PYY, porcine as a reference standard in gi / gut workflows — for example, incretin (glp-1 / gip) receptor signaling and appetite and satiety-circuit research. Human clinical evidence is not established.

Is Peptide YY, PYY, porcine FDA-approved for human use?

No. Peptide YY, PYY, porcine is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is Peptide YY, PYY, porcine typically used in the lab?

In a gi / gut workflow, Peptide YY, PYY, porcine is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. cAMP HTRF, in vitro islet insulin secretion, and food-intake models in rodents.

Sources

View full product page →Back to catalog

Related peptides in GI / Gut

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

Peptide YY, PYY, human
Peptide YY(3-36), PYY, human
[Pro34]Peptide YY, PYY, human
[Leu31, Pro34]Peptide YY, PYY, human
Gastric Inhibitory Peptide, porcine
Gastric Inhibitory Peptide (1-30), amide, porcine
Apelin-13, human, bovine
Ghrelin, rat (palmitoyl)
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.