We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · Pancreatic Polypeptide (human) · Reference sheet

Pancreatic Polypeptide (human)

Reference sheet · Endocrine · CPC catalog code PANP-002

Identity

Name
Pancreatic Polypeptide (human)
Catalog code
PANP-002
Category
Endocrine

Physicochemical properties

Sequence
H-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2 (trifluoroacetate salt)
One-letter
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY
Residues
36 amino acids
Modifications
NH2
Net charge (pH 7)
0 (4 basic / 4 acidic)
Hydrophobic residues
58%
Cysteine present
No

This sequence carries terminal or reporter modifications (NH2), so no molecular formula or weight is published here — the modified mass must come from the lot certificate of analysis. Residue composition and charge describe the peptide backbone only. Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of Pancreatic Polypeptide (human) at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Endocrine class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

Pancreatic Polypeptide (human) sits within the Endocrine research class (CPC reference PANP-002). Endocrine peptides bind class A/B GPCRs and RTKs on hormone-responsive tissues, triggering canonical cAMP, IP₃/Ca²⁺, and MAPK pathways that regulate secretion, growth, and metabolism. Investigators typically incorporate Pancreatic Polypeptide (human) as a reference standard, tool ligand, or substrate in the assay contexts listed above. HTRF cAMP, calcium mobilization (FLIPR), and radioligand binding are the standard readouts.

Studied for

  • Receptor-binding and functional selectivity studies
  • Second-messenger (cAMP / IP₁) profiling
  • Hypothalamic–pituitary axis feedback modeling
  • Metabolic and glucose-homeostasis research

Frequently asked

What is Pancreatic Polypeptide (human)?

Pancreatic Polypeptide (human) (CPC catalog code PANP-002) is a synthetic endocrine research peptide in the endocrine category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is Pancreatic Polypeptide (human) studied for?

Published and internal research programs use Pancreatic Polypeptide (human) as a reference standard in endocrine workflows — for example, receptor-binding and functional selectivity studies and second-messenger (camp / ip₁) profiling. Human clinical evidence is not established.

Is Pancreatic Polypeptide (human) FDA-approved for human use?

No. Pancreatic Polypeptide (human) is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is Pancreatic Polypeptide (human) typically used in the lab?

In a endocrine workflow, Pancreatic Polypeptide (human) is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. HTRF cAMP, calcium mobilization (FLIPR), and radioligand binding are the standard readouts.

Sources

View full product page →Back to catalog

Related peptides in Endocrine

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

Pancreatic Polypeptide (rat)
Pancreatic Polypeptide (bovine)
Insulin beta Chain Peptide (15 – 23)
Insulin B (13 – 23)
Insulin B (9 – 23)
BDC2.5 Mimotope
IGRP Catalytic Subunit – related Protein (206 – 214)
Valosin Peptide (VQY), porcine
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.