We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · Calcitonin, human · Reference sheet

Calcitonin, human

Reference sheet · Bone / Cartilage · CPC catalog code OSTP-014

Identity

Name
Calcitonin, human
Catalog code
OSTP-014
Category
Bone / Cartilage

Physicochemical properties

Sequence
H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (trifluoroacetate salt) (Cys1 and 7 bridge)
One-letter
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
Residues
32 amino acids
Modifications
NH2
Net charge (pH 7)
+0.1 (2 basic / 1 acidic)
Hydrophobic residues
47%
Cysteine present
Yes — disulfide formation and oxidation possible

This sequence carries terminal or reporter modifications (NH2), so no molecular formula or weight is published here — the modified mass must come from the lot certificate of analysis. Residue composition and charge describe the peptide backbone only. Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of Calcitonin, human at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Bone / Cartilage class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

Calcitonin, human sits within the Bone / Cartilage research class (CPC reference OSTP-014). These peptides interact with bone- and cartilage-relevant receptors and matrix proteins — including RANK/RANKL, PTH1R, integrins, and collagen-binding motifs — modulating osteoblast, osteoclast, and chondrocyte activity in cellular and organ-culture models. Investigators typically incorporate Calcitonin, human as a reference standard, tool ligand, or substrate in the assay contexts listed above. Commonly paired with ALP, TRAP, or Alizarin Red staining in cell-based readouts.

Studied for

  • Osteoblast / osteoclast differentiation assays
  • Chondrocyte and cartilage-explant remodeling studies
  • Bone-resorption and mineralization models
  • Biomaterial functionalization for orthopaedic scaffolds

Frequently asked

What is Calcitonin, human?

Calcitonin, human (CPC catalog code OSTP-014) is a synthetic bone / cartilage biology peptide in the bone / cartilage category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is Calcitonin, human studied for?

Published and internal research programs use Calcitonin, human as a reference standard in bone / cartilage workflows — for example, osteoblast / osteoclast differentiation assays and chondrocyte and cartilage-explant remodeling studies. Human clinical evidence is not established.

Is Calcitonin, human FDA-approved for human use?

No. Calcitonin, human is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is Calcitonin, human typically used in the lab?

In a bone / cartilage workflow, Calcitonin, human is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. Commonly paired with ALP, TRAP, or Alizarin Red staining in cell-based readouts.

Sources

View full product page →Back to catalog

Related peptides in Bone / Cartilage

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

Calcitonin, rat
Calcitonin, salmon
Calcitonin, chicken
Calcitonin Gene Related Peptide, rat
Calcitonin Gene Related Peptide, human
Calcitonin Gene Related Peptide II, human
[Tyr0] Calcitonin Gene Related Peptide, rat
[Tyr0] Calcitonin Gene Related Peptide, human
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.