We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · Neuropeptide Y, human, Free Acid · Reference sheet

Neuropeptide Y, human, Free Acid

Reference sheet · Neuropeptides · CPC catalog code NEUP-105

Identity

Name
Neuropeptide Y, human, Free Acid
Catalog code
NEUP-105
Category
Neuropeptides

Physicochemical properties

Sequence
H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-OH (trifluoroacetate salt)
One-letter
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Residues
36 amino acids
Molecular formula
C189H284N54O58S computed from sequence
Molecular weight
4272.73 g/mol average mass, free peptide, computed
Net charge (pH 7)
+0.1 (6 basic / 5 acidic)
Hydrophobic residues
50%
Cysteine present
No

Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of Neuropeptide Y, human, Free Acid at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Neuropeptides class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

Neuropeptide Y, human, Free Acid sits within the Neuropeptides research class (CPC reference NEUP-105). Neuropeptides bind GPCRs expressed on central and peripheral neurons — modulating cAMP, calcium, and β-arrestin signaling to shape neurotransmission, network excitability, and behavior. Investigators typically incorporate Neuropeptide Y, human, Free Acid as a reference standard, tool ligand, or substrate in the assay contexts listed above. Radioligand binding, cAMP HTRF, calcium mobilization, and in vivo behavior assays.

Studied for

  • GPCR receptor-binding and functional profiling
  • Behavioral pharmacology (rodent models)
  • Pain, mood, and anxiety-circuit research
  • Neuroendocrine feedback studies

Frequently asked

What is Neuropeptide Y, human, Free Acid?

Neuropeptide Y, human, Free Acid (CPC catalog code NEUP-105) is a synthetic neuropeptide receptor ligand in the neuropeptides category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is Neuropeptide Y, human, Free Acid studied for?

Published and internal research programs use Neuropeptide Y, human, Free Acid as a reference standard in neuropeptides workflows — for example, gpcr receptor-binding and functional profiling and behavioral pharmacology (rodent models). Human clinical evidence is not established.

Is Neuropeptide Y, human, Free Acid FDA-approved for human use?

No. Neuropeptide Y, human, Free Acid is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is Neuropeptide Y, human, Free Acid typically used in the lab?

In a neuropeptides workflow, Neuropeptide Y, human, Free Acid is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. Radioligand binding, cAMP HTRF, calcium mobilization, and in vivo behavior assays.

Sources

View full product page →Back to catalog

Related peptides in Neuropeptides

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

Neuropeptide S (human)
Neuropeptide Y, human
Neuropeptide S (rat)
[Pro34] Neuropeptide Y, porcine
Neuropeptide S (1-10) (human)
[Leu31,Pro34] Neuropeptide Y, human
Neuropeptide Y (13-36), human
Neuropeptide Y (3-36), human
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.