We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · LL-37-Cys · Reference sheet

LL-37-Cys

Reference sheet · Antimicrobial · CPC catalog code LL37-007

Identity

Name
LL-37-Cys
Catalog code
LL37-007
Category
Antimicrobial

Physicochemical properties

Sequence
H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-Cys-OH (trifluoroacetate salt)
One-letter
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC
Residues
38 amino acids
Molecular formula
C208H345N61O54S computed from sequence
Molecular weight
4596.48 g/mol average mass, free peptide, computed
Net charge (pH 7)
+6 (11 basic / 5 acidic)
Hydrophobic residues
39%
Cysteine present
Yes — disulfide formation and oxidation possible

Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of LL-37-Cys at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Antimicrobial class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

LL-37-Cys sits within the Antimicrobial research class (CPC reference LL37-007). Antimicrobial peptides typically disrupt bacterial, fungal, or viral membranes through direct electrostatic and hydrophobic interactions, or by triggering intracellular targets after translocation. Assay potency is usually reported as MIC (minimum inhibitory concentration) against reference strains. Investigators typically incorporate LL-37-Cys as a reference standard, tool ligand, or substrate in the assay contexts listed above. Most commonly used in broth microdilution MIC assays (CLSI M07), radial diffusion assays, and membrane-permeabilization (SYTOX / DiSC₃-5) readouts.

Studied for

  • Minimum inhibitory concentration (MIC) screens against Gram-positive and Gram-negative panels
  • Biofilm disruption and anti-biofilm surface coatings
  • Structure–activity relationship (SAR) studies for AMP analogues
  • Host-defense and innate-immunity mechanistic work

Frequently asked

What is LL-37-Cys?

LL-37-Cys (CPC catalog code LL37-007) is a synthetic antimicrobial peptide (amp) reference standard in the antimicrobial category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is LL-37-Cys studied for?

Published and internal research programs use LL-37-Cys as a reference standard in antimicrobial workflows — for example, minimum inhibitory concentration (mic) screens against gram-positive and gram-negative panels and biofilm disruption and anti-biofilm surface coatings. Human clinical evidence is not established.

Is LL-37-Cys FDA-approved for human use?

No. LL-37-Cys is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is LL-37-Cys typically used in the lab?

In a antimicrobial workflow, LL-37-Cys is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. Most commonly used in broth microdilution MIC assays (CLSI M07), radial diffusion assays, and membrane-permeabilization (SYTOX / DiSC₃-5) readouts.

Sources

View full product page →Back to catalog

Related peptides in Antimicrobial

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

Biotinyl-LL-37 amide
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.