We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · GLP-1/Glucagon-Like Peptide, amide, human · Reference sheet

GLP-1/Glucagon-Like Peptide, amide, human

Reference sheet · Endocrine · CPC catalog code GLUC-009

Identity

Name
GLP-1/Glucagon-Like Peptide, amide, human
Catalog code
GLUC-009
Category
Endocrine

Physicochemical properties

Sequence
H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 (trifluoroacetate salt)
One-letter
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Residues
36 amino acids
Modifications
NH2
Net charge (pH 7)
-2.8 (6 basic / 7 acidic)
Hydrophobic residues
39%
Cysteine present
No

This sequence carries terminal or reporter modifications (NH2), so no molecular formula or weight is published here — the modified mass must come from the lot certificate of analysis. Residue composition and charge describe the peptide backbone only. Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of GLP-1/Glucagon-Like Peptide, amide, human at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Endocrine class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

GLP-1/Glucagon-Like Peptide, amide, human sits within the Endocrine research class (CPC reference GLUC-009). Endocrine peptides bind class A/B GPCRs and RTKs on hormone-responsive tissues, triggering canonical cAMP, IP₃/Ca²⁺, and MAPK pathways that regulate secretion, growth, and metabolism. Investigators typically incorporate GLP-1/Glucagon-Like Peptide, amide, human as a reference standard, tool ligand, or substrate in the assay contexts listed above. HTRF cAMP, calcium mobilization (FLIPR), and radioligand binding are the standard readouts.

Studied for

  • Receptor-binding and functional selectivity studies
  • Second-messenger (cAMP / IP₁) profiling
  • Hypothalamic–pituitary axis feedback modeling
  • Metabolic and glucose-homeostasis research

Frequently asked

What is GLP-1/Glucagon-Like Peptide, amide, human?

GLP-1/Glucagon-Like Peptide, amide, human (CPC catalog code GLUC-009) is a synthetic endocrine research peptide in the endocrine category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is GLP-1/Glucagon-Like Peptide, amide, human studied for?

Published and internal research programs use GLP-1/Glucagon-Like Peptide, amide, human as a reference standard in endocrine workflows — for example, receptor-binding and functional selectivity studies and second-messenger (camp / ip₁) profiling. Human clinical evidence is not established.

Is GLP-1/Glucagon-Like Peptide, amide, human FDA-approved for human use?

No. GLP-1/Glucagon-Like Peptide, amide, human is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is GLP-1/Glucagon-Like Peptide, amide, human typically used in the lab?

In a endocrine workflow, GLP-1/Glucagon-Like Peptide, amide, human is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. HTRF cAMP, calcium mobilization (FLIPR), and radioligand binding are the standard readouts.

Sources

View full product page →Back to catalog

Related peptides in Endocrine

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

GLP-1/Glucagon-Like Peptide, human
Glucagon-Like Peptide I (7-36), amide, human
Glucagon-Like Peptide II, human
Glucagon-Like Peptide II, rat
GLP-1 (7-36), amide, chicken, common turkey
(Ser8)-GLP-1 (7-36), amide, human
[Des-His1,Glu9] Glucagon, amide
Glucagon, human
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.