We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · CRAMP (mouse) · Reference sheet

CRAMP (mouse)

Reference sheet · Signaling · CPC catalog code CRAM-001

Identity

Name
CRAMP (mouse)
Catalog code
CRAM-001
Category
Signaling

Physicochemical properties

Sequence
H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH (trifluoroacetate salt)
One-letter
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Residues
34 amino acids
Molecular formula
C178H302N50O46 computed from sequence
Molecular weight
3878.68 g/mol average mass, free peptide, computed
Net charge (pH 7)
+6 (9 basic / 3 acidic)
Hydrophobic residues
35%
Cysteine present
No

Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of CRAMP (mouse) at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Signaling class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

CRAMP (mouse) sits within the Signaling research class (CPC reference CRAM-001). Signaling peptides mimic recognition motifs (phosphotyrosine motifs, PDZ ligands, kinase docking sites) or interfere with protein–protein interactions inside the cell, allowing focused perturbation of a single node in a pathway. Investigators typically incorporate CRAMP (mouse) as a reference standard, tool ligand, or substrate in the assay contexts listed above. SPR, BLI, AlphaScreen, and pulldown / Western readouts.

Studied for

  • Protein–protein interaction (PPI) mapping
  • SH2, SH3, PDZ, and 14-3-3 binding studies
  • Allosteric modulator and PPI-inhibitor discovery
  • Signal-pathway dissection in cellular models

Frequently asked

What is CRAMP (mouse)?

CRAMP (mouse) (CPC catalog code CRAM-001) is a synthetic cell-signaling research peptide in the signaling category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is CRAMP (mouse) studied for?

Published and internal research programs use CRAMP (mouse) as a reference standard in signaling workflows — for example, protein–protein interaction (ppi) mapping and sh2, sh3, pdz, and 14-3-3 binding studies. Human clinical evidence is not established.

Is CRAMP (mouse) FDA-approved for human use?

No. CRAMP (mouse) is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is CRAMP (mouse) typically used in the lab?

In a signaling workflow, CRAMP (mouse) is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. SPR, BLI, AlphaScreen, and pulldown / Western readouts.

Sources

View full product page →Back to catalog

Related peptides in Signaling

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

Head activator
IL-8 Inhibitor
Guanylin, human
IL-8 (-5 to +5)
Uroguanylin, human
IRBP (1-20), human
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.