We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · Charybdotoxin · Reference sheet

Charybdotoxin

Reference sheet · Ion Channel Toxins · CPC catalog code CHAT-001

Identity

Name
Charybdotoxin
Catalog code
CHAT-001
Category
Ion Channel Toxins

Physicochemical properties

Sequence
Glp-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (trifluoroacetate salt) (Cys7 and Cys28
One-letter
FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS
Residues
36 amino acids
Modifications
Glp
Net charge (pH 7)
+6.1 (8 basic / 1 acidic)
Hydrophobic residues
36%
Cysteine present
Yes — disulfide formation and oxidation possible

This sequence carries terminal or reporter modifications (Glp), so no molecular formula or weight is published here — the modified mass must come from the lot certificate of analysis. Residue composition and charge describe the peptide backbone only. Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of Charybdotoxin at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Ion Channel Toxins class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

Charybdotoxin sits within the Ion Channel Toxins research class (CPC reference CHAT-001). Ion-channel toxins bind with sub-nanomolar affinity to specific channel subtypes (Kv, Nav, Cav, NMDA), stabilizing closed, open, or inactivated states. They are among the most selective tools available for dissecting channel function. Investigators typically incorporate Charybdotoxin as a reference standard, tool ligand, or substrate in the assay contexts listed above. Manual or automated patch clamp (QPatch, Patchliner) and radioligand binding are the standard readouts.

Studied for

  • Patch-clamp characterization of channel subtypes
  • Neuronal excitability and pain-circuit research
  • Cardiac electrophysiology and arrhythmia models
  • Structure–function mapping of channel pores

Frequently asked

What is Charybdotoxin?

Charybdotoxin (CPC catalog code CHAT-001) is a synthetic ion-channel toxin (research reagent) in the ion channel toxins category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is Charybdotoxin studied for?

Published and internal research programs use Charybdotoxin as a reference standard in ion channel toxins workflows — for example, patch-clamp characterization of channel subtypes and neuronal excitability and pain-circuit research. Human clinical evidence is not established.

Is Charybdotoxin FDA-approved for human use?

No. Charybdotoxin is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is Charybdotoxin typically used in the lab?

In a ion channel toxins workflow, Charybdotoxin is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. Manual or automated patch clamp (QPatch, Patchliner) and radioligand binding are the standard readouts.

Sources

View full product page →Back to catalog

Related peptides in Ion Channel Toxins

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

omega-Conotoxin GVIA
Neuropeptide FF (5-8)
omega-Conotoxin MVIIC
omega-Conotoxin MVIIA
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.