We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · p53 Activator, Cell-Permeable · Reference sheet

p53 Activator, Cell-Permeable

Reference sheet · Enzyme Substrates · CPC catalog code CASP-025

Identity

Name
p53 Activator, Cell-Permeable
Catalog code
CASP-025
Category
Enzyme Substrates

Physicochemical properties

Sequence
H-Gly-Ser-Arg-Ala-His-Ser-Ser-His-Leu-Lys-Ser-Lys-Lys-Gly-Gln-Ser-Thr-Ser-Arg-His-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly-OH (trifluoroacetate salt)
One-letter
GSRAHSSHLKSKKGQSTSRHKKWKMRRNQFWVKVQRG
Residues
37 amino acids
Molecular formula
C192H315N71O49S computed from sequence
Molecular weight
4434.14 g/mol average mass, free peptide, computed
Net charge (pH 7)
+12.3 (15 basic / 0 acidic)
Hydrophobic residues
22%
Cysteine present
No

Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of p53 Activator, Cell-Permeable at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Enzyme Substrates class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

p53 Activator, Cell-Permeable sits within the Enzyme Substrates research class (CPC reference CASP-025). The peptide encodes a recognition sequence flanked by a reporter group (pNA, AMC, MCA, FAM/DABCYL). Enzyme cleavage releases the reporter, producing a quantifiable optical signal proportional to catalytic activity. Investigators typically incorporate p53 Activator, Cell-Permeable as a reference standard, tool ligand, or substrate in the assay contexts listed above. Read on kinetic plate readers with the reporter-appropriate filter set (e.g. 405 nm, 380/460 nm).

Studied for

  • Kinetic (kcat / Km) characterization of proteases and hydrolases
  • High-throughput inhibitor screening
  • Selectivity profiling across related enzyme families
  • Diagnostic and academic activity assays

Frequently asked

What is p53 Activator, Cell-Permeable?

p53 Activator, Cell-Permeable (CPC catalog code CASP-025) is a synthetic enzyme substrate (research reagent) in the enzyme substrates category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is p53 Activator, Cell-Permeable studied for?

Published and internal research programs use p53 Activator, Cell-Permeable as a reference standard in enzyme substrates workflows — for example, kinetic (kcat / km) characterization of proteases and hydrolases and high-throughput inhibitor screening. Human clinical evidence is not established.

Is p53 Activator, Cell-Permeable FDA-approved for human use?

No. p53 Activator, Cell-Permeable is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is p53 Activator, Cell-Permeable typically used in the lab?

In a enzyme substrates workflow, p53 Activator, Cell-Permeable is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. Read on kinetic plate readers with the reporter-appropriate filter set (e.g. 405 nm, 380/460 nm).

Sources

View full product page →Back to catalog

Related peptides in Enzyme Substrates

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

Caspase Inhibitor II, Cell-Permeable
Caspase-1 Inhibitor I, Cell-Permeable
Caspase-3 Inhibitor I, Cell-Permeable
Caspase-8 Inhibitor I, Cell Permeable
GSK-3beta Peptide Inhibitor, Cell Permeable
Ac-N-Me-Tyr-Val-Ala-Asp-CHO
GSK-3beta Peptide Inhibitor
Ac-Tyr-N-Me-Val-Ala-N-Me-Asp-CHO
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.