We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · Agouti-related Protein (AGRP) (87-132) human, acetyl · Reference sheet

Agouti-related Protein (AGRP) (87-132) human, acetyl

Reference sheet · Neuropeptides · CPC catalog code AGOU-002

Identity

Name
Agouti-related Protein (AGRP) (87-132) human, acetyl
Catalog code
AGOU-002
Category
Neuropeptides

Physicochemical properties

Sequence
Ac-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr-OH (trifluoroacetate salt) (Cys1-16
One-letter
CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
Residues
46 amino acids
Modifications
Ac
Net charge (pH 7)
+3.1 (6 basic / 2 acidic)
Hydrophobic residues
59%
Cysteine present
Yes — disulfide formation and oxidation possible

This sequence carries terminal or reporter modifications (Ac), so no molecular formula or weight is published here — the modified mass must come from the lot certificate of analysis. Residue composition and charge describe the peptide backbone only. Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of Agouti-related Protein (AGRP) (87-132) human, acetyl at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Neuropeptides class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

Agouti-related Protein (AGRP) (87-132) human, acetyl sits within the Neuropeptides research class (CPC reference AGOU-002). Neuropeptides bind GPCRs expressed on central and peripheral neurons — modulating cAMP, calcium, and β-arrestin signaling to shape neurotransmission, network excitability, and behavior. Investigators typically incorporate Agouti-related Protein (AGRP) (87-132) human, acetyl as a reference standard, tool ligand, or substrate in the assay contexts listed above. Radioligand binding, cAMP HTRF, calcium mobilization, and in vivo behavior assays.

Studied for

  • GPCR receptor-binding and functional profiling
  • Behavioral pharmacology (rodent models)
  • Pain, mood, and anxiety-circuit research
  • Neuroendocrine feedback studies

Frequently asked

What is Agouti-related Protein (AGRP) (87-132) human, acetyl?

Agouti-related Protein (AGRP) (87-132) human, acetyl (CPC catalog code AGOU-002) is a synthetic neuropeptide receptor ligand in the neuropeptides category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is Agouti-related Protein (AGRP) (87-132) human, acetyl studied for?

Published and internal research programs use Agouti-related Protein (AGRP) (87-132) human, acetyl as a reference standard in neuropeptides workflows — for example, gpcr receptor-binding and functional profiling and behavioral pharmacology (rodent models). Human clinical evidence is not established.

Is Agouti-related Protein (AGRP) (87-132) human, acetyl FDA-approved for human use?

No. Agouti-related Protein (AGRP) (87-132) human, acetyl is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is Agouti-related Protein (AGRP) (87-132) human, acetyl typically used in the lab?

In a neuropeptides workflow, Agouti-related Protein (AGRP) (87-132) human, acetyl is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. Radioligand binding, cAMP HTRF, calcium mobilization, and in vivo behavior assays.

Sources

View full product page →Back to catalog

Related peptides in Neuropeptides

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

Agouti-related Protein (AGRP) (83-132) Amide (human)
Myelin Basic Protein (87-99) (human, bovine, rat)
(Ala96)-Myelin Basic Protein (87-99) (human, bovine, rat)
Acetyl-Myelin Basic Protein (135-145) (human)
Myelin Basic Protein (68-82), guinea pig
Myelin Proteolipid Protein (139-151) (depalmitoylated) (human, bovine, dog, mouse, rat)
Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat)
Myelin Oligodendrocyte Glycoprotein (MOG) (35-55) (human)
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.