We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · Adrenomedullin (1-52), porcine · Reference sheet

Adrenomedullin (1-52), porcine

Reference sheet · Cardiovascular · CPC catalog code ADRM-012

Identity

Name
Adrenomedullin (1-52), porcine
Catalog code
ADRM-012
Category
Cardiovascular

Physicochemical properties

Sequence
H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt) (Cys16 and 21 bridge)
One-letter
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY
Residues
52 amino acids
Modifications
NH2
Net charge (pH 7)
+5.1 (9 basic / 3 acidic)
Hydrophobic residues
38%
Cysteine present
Yes — disulfide formation and oxidation possible

This sequence carries terminal or reporter modifications (NH2), so no molecular formula or weight is published here — the modified mass must come from the lot certificate of analysis. Residue composition and charge describe the peptide backbone only. Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of Adrenomedullin (1-52), porcine at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Cardiovascular class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

Adrenomedullin (1-52), porcine sits within the Cardiovascular research class (CPC reference ADRM-012). Cardiovascular peptides act on GPCRs and receptor systems in vascular smooth muscle, endothelium, and cardiac myocytes — modulating vasoconstriction, natriuresis, RAAS signaling, or ionotropic responses. Effects are typically measured in isolated vessel, Langendorff heart, or receptor-transfected cell assays.</ Investigators typically incorporate Adrenomedullin (1-52), porcine as a reference standard, tool ligand, or substrate in the assay contexts listed above. Radioligand-binding, IP-1 / cAMP HTRF, and organ-bath tension recordings are the standard readouts.

Studied for

  • Vascular reactivity in aortic ring and mesenteric bed preparations
  • Renin–angiotensin–aldosterone system (RAAS) mechanistic studies
  • Natriuretic and diuretic pathway characterization
  • Cardiac remodeling and hypertrophy models

Frequently asked

What is Adrenomedullin (1-52), porcine?

Adrenomedullin (1-52), porcine (CPC catalog code ADRM-012) is a synthetic cardiovascular research peptide in the cardiovascular category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is Adrenomedullin (1-52), porcine studied for?

Published and internal research programs use Adrenomedullin (1-52), porcine as a reference standard in cardiovascular workflows — for example, vascular reactivity in aortic ring and mesenteric bed preparations and renin–angiotensin–aldosterone system (raas) mechanistic studies. Human clinical evidence is not established.

Is Adrenomedullin (1-52), porcine FDA-approved for human use?

No. Adrenomedullin (1-52), porcine is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is Adrenomedullin (1-52), porcine typically used in the lab?

In a cardiovascular workflow, Adrenomedullin (1-52), porcine is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. Radioligand-binding, IP-1 / cAMP HTRF, and organ-bath tension recordings are the standard readouts.

Sources

View full product page →Back to catalog

Related peptides in Cardiovascular

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

Adrenomedullin (1-52), human
Adrenomedullin (13-52), human
Adrenomedullin (22-52), human
Pro-Adrenomedullin (N-20), porcine
Adrenomedullin (1-12), human
Adrenomedullin (1-50), rat
Pro-Adrenomedullin (N-20), rat
Pro-Adrenomedullin (N-20), human
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.